ironquill.tech/board

$ cat jobs/senior-technical-services-engineer-melio-bc364c67283b.json

Senior Technical Services Engineer

Melio·Worldwide·Tel Aviv·senior
pythonjavascripttypescriptsqlawssredatadogserverless
Apply on greenhouse → Get AI match score →
We are looking for an experienced Senior Technical Services Engineer to join our dynamic team based in Israel. You will play a critical role in ensuring the smooth operation of our technical infrastructure and product flows. Your responsibilities will include providing tier 3 technical support for escalated issues, taking charge of building monitors, maintaining continuous vigilance over the production environment, and taking the lead in coordinating incident response efforts across different departments. Qualifications: 5+ years of experience in Tier 3/4 Technical Support, Production Engineering, or a highly technical SRE-adjacent role. A strong technical background with proven experience in troubleshooting and debugging complex issues. Troubleshooting Specialist: Expert at using debugging tools, browser dev tools, Postman, and log aggregators (Datadog/Splunk/ELK). Experience in incident management, including leading cross-domain incident management efforts. SQL Expert: Strong proficiency in SQL with experience handling complex relational databases in a production setting. Proactive approach, taking the initiative to start processes and spot potential issues before they come up Proven ability to read and understand code (JS/TypeScript/Python) to assist in bug isolation. Incident Management: experience with managing the lifecycle of production incidents. Communication: English and Hebrew; ability to translate complex technical "noise" into clear, actionable signals for R&D. Ability to thrive in a fast-paced, dynamic environment. Bonus points: Experience in the Fintech industry (understanding of ledgers, payments, or clearing). Familiarity with AWS Lambda and serverless architecture. Prior experience as a Software Developer who transitioned into high-level support/production engineering. A day in the life and how you’ll make an impact: Lead cross-functional efforts to identify, analyze, and address intricate technical challenges, fostering seamless collaboration betw

Similar remote roles

Full Stack Developer
Accenture Baltics · Worldwide · mid
Sr Lead Software Engineer, Full Stack - Shopping (Remote-Eligible)
capital one national association · US · senior
Full Stack Developer
Accenture Federal Services · Worldwide · mid
Senior Full Stack Engineer - ClickStack
ClickHouse · Worldwide · senior
Full Stack Software Development Engineer React / Node.js
Launchmetrics · Worldwide · mid
Full Stack Software Development Engineer React / Node.js
Launchmetrics · Worldwide · mid
Senior Platform Engineer
State Street · Worldwide · senior
Full Stack Engineer
Metrikflow · Worldwide · mid